Cat#:FPA-49019P;Product Name:Rabbit Anti-TSPAN11 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TSPAN11 aa 125-174 (internal sequence). The exact sequence is proprietary. Sequence: HLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLRE Database link: A1L157 Run BLAST with Run BLAST with;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Constituents: 98% PBS, 2% Sucrose;
Synthetic peptide within Human TSPAN11 aa 125-174 (internal sequence). The exact sequence is proprietary. Sequence: HLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLRE Database link: A1L157 Run BLAST with Run BLAST with