Rabbit Anti-TSH Receptor Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-43125P

• Product Name:
• Rabbit Anti-TSH Receptor Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TSH Receptor aa 31-80. The exact sequence is proprietary. Sequence: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR

• Species Reactivity:
• Human Predicted to work with: Sheep, Horse, Cow, Cat, Dog, African green monkey

• Isotype:
• IgG

• Application:
• ELISA, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid