Rabbit Anti-TRM1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42966P

• Product Name:
• Rabbit Anti-TRM1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TRM1 aa 25-75. The exact sequence is proprietary. Sequence: EWQSPGLPNTAAMENGTGPYGEERPREVQETTVTEGAAKIAFPSANEVFY N

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7-8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid