Cat#:FPA-42933P;Product Name:Rabbit Anti-Tripartite motif-containing protein 77 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human Tripartite motif-containing protein 77 aa 34-107. Sequence: FCSPCLCLLWEDTLTPNCCPVCREISQQMYFKRIIFAEKQVIPTRESVPC QLSSSAMLICRRHQEIKNLICETD ;Species Reactivity:Human;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-Tripartite motif-containing protein 77 Polyclonal Antibody
Online Inquiry
Cat#:
FPA-42933P
Product Name:
Rabbit Anti-Tripartite motif-containing protein 77 Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Recombinant fragment corresponding to Human Tripartite motif-containing protein 77 aa 34-107. Sequence: FCSPCLCLLWEDTLTPNCCPVCREISQQMYFKRIIFAEKQVIPTRESVPC QLSSSAMLICRRHQEIKNLICETD