Rabbit Anti-TRIM49C Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48975P

• Product Name:
• Rabbit Anti-TRIM49C Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TRIM49C aa 51-100 (N terminal). The exact sequence is proprietary. Sequence: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK Database link: P0CI26 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid