Rabbit Anti-TRIM16L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48961P

• Product Name:
• Rabbit Anti-TRIM16L Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TRIM16L aa 11-60 (N terminal). The exact sequence is proprietary. Sequence: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS Database link: Q309B1 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid