Rabbit Anti-Transmembrane protein 30A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42680P

• Product Name:
• Rabbit Anti-Transmembrane protein 30A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Transmembrane protein 30A aa 300-330 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: PVHYFDGRKRMILSTISWMGGKNPFLGIAYI

• Species Reactivity:
• Mouse, Rat Predicted to work with: Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid