Rabbit Anti-Transglutaminase 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48932P

• Product Name:
• Rabbit Anti-Transglutaminase 3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to N terminal aa 1-50 ( MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS ) of Human Transglutaminase 3 (NP_003236) Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid