Cat#:FPA-42631P;Product Name:Rabbit Anti-Transferrin Receptor 2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to a region within N terminal aa 179 - 228 (RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLED P) of Human Transferrin Receptor 2 (NP_003218);Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide, corresponding to a region within N terminal aa 179 - 228 (RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLED P) of Human Transferrin Receptor 2 (NP_003218)
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
Isotype:
IgG
Application:
IHC-P, WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.