Rabbit Anti-Transaldolase 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42609P

• Product Name:
• Rabbit Anti-Transaldolase 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Transaldolase 1 aa 267-317. The exact sequence is proprietary. Sequence: NAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFA A

• Species Reactivity:
• Mouse, Human Predicted to work with: Chimpanzee, Gorilla

• Isotype:
• IgG

• Application:
• IP, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid