Rabbit Anti-TOM1L2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42387P

• Product Name:
• Rabbit Anti-TOM1L2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the internal sequence aa 394-457 ( SLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLR TDLKGDDLEEGVTS ) of Human TOM1L2.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.01% Thimerosal (merthiolate) Constituents: 10% Glycerol, 0.1M Tris, 0.1M Glycine, pH 7.0

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid