• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TOM1L2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-42387P
  • Product Name:
  • Rabbit Anti-TOM1L2 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within the internal sequence aa 394-457 ( SLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLR TDLKGDDLEEGVTS ) of Human TOM1L2.
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.01% Thimerosal (merthiolate) Constituents: 10% Glycerol, 0.1M Tris, 0.1M Glycine, pH 7.0
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TOM1L2 Polyclonal Antibody-FPA-42386P
  • Online Inquiry

    refresh