Rabbit Anti-TOB2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48898P

• Product Name:
• Rabbit Anti-TOB2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human TOB2 aa 202-234. Sequence: GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS Database link: Q14106 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid