Rabbit Anti-TNFAIP8L1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42306P

• Product Name:
• Rabbit Anti-TNFAIP8L1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 136-185 (AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGS L) of human TNFAIP8L1 (NP_689575)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid