Rabbit Anti-TNFAIP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42296P

• Product Name:
• Rabbit Anti-TNFAIP1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Rat TNFAIP1 aa 251-300 (C terminal). The exact sequence is proprietary. (NP_891995). Sequence: LNVLLYETPRVPDNSLLEATSRSRSQASPSEDEDTFELRDRVRRIHVKRY

• Species Reactivity:
• Rat Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid