Rabbit Anti-TMEM2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48837P

• Product Name:
• Rabbit Anti-TMEM2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Mouse TMEM2 aa 1-50 (N terminal). Sequence: MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid