• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TMEM208 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-42139P
  • Product Name:
  • Rabbit Anti-TMEM208 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fragment: PWFTADSGTPAPEHNEKRQRRQERRQMKRL, corresponding to aa 144-173 of Human TMEM208 Isoform 1 (Q9BTX3).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, ICC/IF, IHC-P
  • Storage Buffer:
  • pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TMEM207 Polyclonal Antibody-FPA-42138P
  • Online Inquiry

    refresh