Rabbit Anti-TMEM208 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42139P

• Product Name:
• Rabbit Anti-TMEM208 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment: PWFTADSGTPAPEHNEKRQRRQERRQMKRL, corresponding to aa 144-173 of Human TMEM208 Isoform 1 (Q9BTX3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ICC/IF, IHC-P

• Storage Buffer:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid