Rabbit Anti-TMEM16K Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42102P

• Product Name:
• Rabbit Anti-TMEM16K Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide derived from within residues QALKADIDATLYEQVILEKEMGTYLGTFDD YLELFLQFGYVSLFSCVYPL, corresponding to C terminal aa 467-516 of Human TMEM16K

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid