Rabbit Anti-TMEM132D Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-42063P

• Product Name:
• Rabbit Anti-TMEM132D Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 700-749( QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK ) of Mouse TMEM132D (NP_766473).

• Species Reactivity:
• Mouse, Rat Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 2% Sucrose, 97% PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid