Rabbit Anti-TMEM121 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48810P

• Product Name:
• Rabbit Anti-TMEM121 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TMEM121 aa 13-62 (N terminal). The exact sequence is proprietary. (NP_079544). Sequence: LTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVW Database link: Q9BTD3 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid