• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TMEM107 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-48805P
  • Product Name:
  • Rabbit Anti-TMEM107 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within N terminal aa 21-64 ( VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF ) of Human TMEM107 (NP_115730). Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human Predicted to work with: Horse, Guinea pig, Cat, Dog
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TMEM106B Polyclonal Antibody-FPA-48804P
  • Online Inquiry

    refresh