Rabbit Anti-TMED6 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48801P

• Product Name:
• Rabbit Anti-TMED6 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TMED6 aa 136-185 (C terminal). The exact sequence is proprietary. (NP_653277) Sequence: FGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARM Database link: Q8WW62 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Cat, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid