Rabbit Anti-TM2D3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48785P

• Product Name:
• Rabbit Anti-TM2D3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C-terminal aa 171-220 ( TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGY ) of Mouse TM2D3 (NP_081071; Q8BJ83 isoform 2). Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Human, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid