Rabbit Anti-TLR4/MD2 Complex Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-41953P

• Product Name:
• Rabbit Anti-TLR4/MD2 Complex Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TLR4/MD2 Complex aa 650-700 (internal sequence). The exact sequence is proprietary. Sequence: LVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEG V

• Species Reactivity:
• Human Predicted to work with: Horse, Cow, Macaque monkey

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: 0.05% Sodium azide Constituents: 99% PBS, 0.05% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid