Rabbit Anti-TIP120A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-41841P

• Product Name:
• Rabbit Anti-TIP120A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human TIP120A aa 404-467 (internal sequence). Sequence: QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQC CFNMLTELVNVLPG

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, WB, ICC/IF

• Storage Buffer:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: PBS, 40% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid