Rabbit Anti-TIGD5 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48763P

• Product Name:
• Rabbit Anti-TIGD5 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse TIGD5 aa 38-87 (N terminal). The exact sequence is proprietary. NP_848761 Sequence: PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV Database link: Q499M4 Run BLAST with Run BLAST with

• Species Reactivity:
• Mouse Predicted to work with: Rat, Chicken, Cow, Dog, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid