Rabbit Anti-Thy1.1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48751P

• Product Name:
• Rabbit Anti-Thy1.1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Rat Thy1.1 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVN L Database link: P01830 Run BLAST with Run BLAST with

• Species Reactivity:
• Rat Predicted to work with: Mouse, Sheep, Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Protein A purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Clonality:
• Polyclonal

• Form:
• Liquid