Rabbit Anti-Thioredoxin / TRX Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48740P

• Product Name:
• Rabbit Anti-Thioredoxin / TRX Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Thioredoxin/ TRX aa 65-105 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Database link: P10599 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Protein A purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid