Rabbit Anti-TGF alpha Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-41520P

• Product Name:
• Rabbit Anti-TGF alpha Polyclonal Antibody

• Formulation:
• Lyophilised:Reconstitute with 200µl of sterile water. The reconstituted antibody is stable for at least 2 weeks at 2-8C and at least 6 months at -20C.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein aa 40-89. Sequence: VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

• Species Reactivity:
• Mouse, Human

• Isotype:
• unknown

• Application:
• WB, Neutralising, Sandwich ELISA, ELISA, IHC-P

• Storage Buffer:
• PBS, pH 7.4, no preservative, sterile filtered

• Storage Procedures:
• Store at -20ºC.

• Clonality:
• Polyclonal