Rabbit Anti-TEX36 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48716P

• Product Name:
• Rabbit Anti-TEX36 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TEX36 aa 91-140 (internal sequence). The exact sequence is proprietary. NP_001121674 Sequence: GRKKISPDKRQHVSRNFNLWACDYVPSCLDGFSNNQISYVYKEAMVVSSF Database link: Q5VZQ5 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid