Rabbit Anti-TDRD12 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48692P

• Product Name:
• Rabbit Anti-TDRD12 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TDRD12 aa 289-338 (C terminal). The exact sequence is proprietary. Isoform 2. Sequence: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY Database link: Q587J7-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Horse, Cow, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid