Cat#:FPA-41255P;Product Name:Rabbit Anti-TCP1 theta Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TCP1 theta aa 498-548. The exact sequence is proprietary. Sequence: LDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQN D ;Species Reactivity:Mouse, Human Predicted to work with: Chicken, Cow, Cynomolgus monkey, Orangutan;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline pH: 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human TCP1 theta aa 498-548. The exact sequence is proprietary. Sequence: LDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKKDWDDDQN D
Species Reactivity:
Mouse, Human Predicted to work with: Chicken, Cow, Cynomolgus monkey, Orangutan
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline pH: 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: