Rabbit Anti-TCF7L1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48677P

• Product Name:
• Rabbit Anti-TCF7L1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within N terminal aa 71-120 (ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP G) of Human TCF7L1 (NP_112573)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid