Rabbit Anti-TBRG1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48660P

• Product Name:
• Rabbit Anti-TBRG1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TBRG1 aa 172-221 (C terminal). The exact sequence is proprietary. Isoform 2 Sequence: DVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDPLLPGSLDLPELQ Database link: Q3YBR2-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid