Cat#:FPA-41135P;Product Name:Rabbit Anti-Tbp7 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to N terminal aa 1-50 ( MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE ) of Human Tbp7 (NP_006494) ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;