• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TBLR1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-41124P
  • Product Name:
  • Rabbit Anti-TBLR1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide: WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEW T , corresponding to aa 200-250 of Human TBLR1.
  • Species Reactivity:
  • Mouse, Rat, Human
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: 0.05% Sodium Azide Constituents: PBS, 0.2% gelatin.
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TBLR1 Polyclonal Antibody-FPA-41123P
  • Online Inquiry

    refresh