Rabbit Anti-TBLR1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-41124P

• Product Name:
• Rabbit Anti-TBLR1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide: WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEW T , corresponding to aa 200-250 of Human TBLR1.

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.05% Sodium Azide Constituents: PBS, 0.2% gelatin.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid