Rabbit Anti-TBKBP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48658P

• Product Name:
• Rabbit Anti-TBKBP1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human TBKBP1 aa 116-165 (N terminal). The exact sequence is proprietary. Sequence: ELQKNKEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGL Database link: A7MCY6 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid