• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-TBC1D1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-41053P
  • Product Name:
  • Rabbit Anti-TBC1D1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within internal sequence aa 611-660 (RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS W) of Human TBC1D1 (NP_055988)
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat
  • Isotype:
  • IgG
  • Application:
  • IHC-P, WB
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TAZ Polyclonal Antibody-FPA-41052P
  • Online Inquiry

    refresh