Rabbit Anti-TBC1D1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-41053P

• Product Name:
• Rabbit Anti-TBC1D1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 611-660 (RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS W) of Human TBC1D1 (NP_055988)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid