Rabbit Anti-TBC1D16 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48644P

• Product Name:
• Rabbit Anti-TBC1D16 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human TBC1D16 aa 71-120 (N terminal). Sequence: EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG Database link: Q8TBP0 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid