Cat#:FPA-41059P;Product Name:Rabbit Anti-TBC1D10A Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TBC1D10A aa 458-508 (C terminal). The exact sequence is proprietary. NP_114143.1 Sequence: AAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTY L ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Sheep, Cow, Cat, Pig, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human TBC1D10A aa 458-508 (C terminal). The exact sequence is proprietary. NP_114143.1 Sequence: AAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTY L
Species Reactivity:
Mouse, Human Predicted to work with: Rat, Sheep, Cow, Cat, Pig, Rhesus monkey, Gorilla, Orangutan
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: