Rabbit Anti-TARP Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48622P

• Product Name:
• Rabbit Anti-TARP Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 7-56 ( YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK ) of Human TARP (NP_001003806). Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Horse

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 97% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid