• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Tafazzin / TAZ Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-48613P
  • Product Name:
  • Rabbit Anti-Tafazzin / TAZ Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human Tafazzin/ TAZ aa 226-292 (C terminal). The exact sequence is proprietary. Sequence: PYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQ HLKTQAEQLHNHLQPGR Database link: Q16635 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • IHC-P
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • pH: 7.00 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 89% PBS, 10% Glycerol
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-TAF8 Polyclonal Antibody-FPA-48612P
  • Online Inquiry

    refresh