Rabbit Anti-TAF7L Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40882P

• Product Name:
• Rabbit Anti-TAF7L Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Mouse TAF7L aa 415-464 (C terminal). The exact sequence is proprietary. Sequence: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ

• Species Reactivity:
• Mouse Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid