Cat#:FPA-40876P;Product Name:Rabbit Anti-TAF6L Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to a region within internal sequence aa 180-229 ( PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS ) of Rat TAF6L (NP_001101045). ;Species Reactivity:Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 97% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide, corresponding to a region within internal sequence aa 180-229 ( PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS ) of Rat TAF6L (NP_001101045).
Species Reactivity:
Rat Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 97% PBS, 2% Sucrose
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.