Rabbit Anti-TAF3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48608P

• Product Name:
• Rabbit Anti-TAF3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region from internal sequence aa 540-589 ( RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK ) of Human TAF3 (NP_114129) Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Guinea pig, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid