Cat#:FPA-40799P;Product Name:Rabbit Anti-SYTL5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human SYTL5 aa 600-650 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: TAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIH P ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:Aqueous buffered solution containing 100ug/ml BSA, 50% glycerol and 0.09% sodium azide.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human SYTL5 aa 600-650 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: TAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIH P