Cat#:FPA-40657P;Product Name:Rabbit Anti-Synaptogyrin 1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Synaptogyrin 1 aa 183-233. The exact sequence is proprietary. (NP_004702.2). Sequence: QDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQG Y ;Species Reactivity:Mouse, Human Predicted to work with: Dog, Pig, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Synaptogyrin 1 aa 183-233. The exact sequence is proprietary. (NP_004702.2). Sequence: QDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQGYQSQG Y
Species Reactivity:
Mouse, Human Predicted to work with: Dog, Pig, Rhesus monkey, Gorilla, Orangutan
Isotype:
IgG
Application:
IP, WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.