Rabbit Anti-SYAP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40618P

• Product Name:
• Rabbit Anti-SYAP1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human SYAP1 aa 165-215 conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: DQMYPVALVMLQEDELLSKMRFALVPKLVKEEVFWRNYFYRVSLIKQSAQ L

• Species Reactivity:
• Mouse, Rat, Chicken, Human

• Isotype:
• IgG

• Application:
• ICC/IF, IHC-P, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid