• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-SULT2B1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-40506P
  • Product Name:
  • Rabbit Anti-SULT2B1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within internal sequence aa 143-192 ( YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI ) of Human SULT2B1 (NP_004596).
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Isotype:
  • IgG
  • Application:
  • ELISA, WB, ICC/IF
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-SULT2A1 Polyclonal Antibody-FPA-40505P
  • Online Inquiry

    refresh