Rabbit Anti-SULT2B1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40506P

• Product Name:
• Rabbit Anti-SULT2B1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 143-192 ( YSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFI ) of Human SULT2B1 (NP_004596).

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• ELISA, WB, ICC/IF

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid