Rabbit Anti-STX11 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40457P

• Product Name:
• Rabbit Anti-STX11 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Fusion protein corresponding to Human STX11 aa 1-287. Full length fusion protein: The identity of the protein fusion partner is GST Sequence: MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRD IQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVI HCKLRAMKELS

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.4 Preservative: 0.05% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid