Rabbit Anti-STOX2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-40419P

• Product Name:
• Rabbit Anti-STOX2 Polyclonal Antibody

• Formulation:
• There are 2 isoforms produced by alternative splicing.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human STOX2 aa 787-836 (C terminal). The exact sequence is proprietary. Isoform 2 Sequence: NKNTEEEKNREDVGTMQWLLEREKERDLQRKFEKNLTLLAPKETDSSSNQ

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal